PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XP7N7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 253aa    MW: 28968.7 Da    PI: 5.6463
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XP7N7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W  +a+  g+ R++k+c++rw +yl
      Araip.XP7N7 20 KGLWSPEEDEKLMRYMMNNGQGCWGEVAKNAGLQRCGKSCRLRWINYL 67
                     678*******************************************97 PP

2Myb_DNA-binding49.87.6e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++
      Araip.XP7N7  73 RGAFSPQEQQLIIHLHSLLGNR-WSQIAAQLP-GRTDNEIKNFWNS 116
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-231370IPR009057Homeodomain-like
PROSITE profilePS5129415.5351567IPR017930Myb domain
SuperFamilySSF466893.79E-2818114IPR009057Homeodomain-like
SMARTSM007175.6E-111969IPR001005SANT/Myb domain
PfamPF002495.1E-142067IPR001005SANT/Myb domain
CDDcd001677.11E-92367No hitNo description
PROSITE profilePS5129425.21768122IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2571121IPR009057Homeodomain-like
SMARTSM007175.2E-1572120IPR001005SANT/Myb domain
PfamPF002498.0E-1573116IPR001005SANT/Myb domain
CDDcd001671.08E-975115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MMSKDNDEEK NNKSKNKLRK GLWSPEEDEK LMRYMMNNGQ GCWGEVAKNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE QQLIIHLHSL LGNRWSQIAA QLPGRTDNEI KNFWNSTIKK  120
RCITITSSST SQNTSESYSS SWLEPHDHNS MEGFTMMPMF SCSSSQSPSI IIDEHLPMPM  180
ENNNMHAAMG INNNNNNMFV PPLLESATTS NVYFDNKVVN VEEDSLISME DWELEDLMMI  240
KSVSSPFLDF PLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28181245110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169405.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A151UEN08e-81A0A151UEN0_CAJCA; Transcription factor MYB46
STRINGGLYMA11G14200.24e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.15e-65myb domain protein 46